PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019131m
Common NameCICLE_v10019131mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 691aa    MW: 77377.3 Da    PI: 6.9807
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019131mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.71.1e-23123222197
                      EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      f kvlt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + ++
  Ciclev10019131m 123 FSKVLTASDTSTHGGFSVLRKHATEClppldMNQSTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGEN 214
                      88****************************9445555669************************************************..4499 PP

                      E..EEEEE CS
               B3  90 felvvkvf 97 
                      +el+v+v+
  Ciclev10019131m 215 GELHVGVR 222
                      999**996 PP

2Auxin_resp105.56.2e-35249328183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t+++F v+Y+Pr+  s+F+++++k+++a+++k++vGmR+km+fe+eds+ rr+sGtvvgv+d++p +W++SkWrsLk
  Ciclev10019131m 249 ASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPDRRFSGTVVGVEDFSP-HWKDSKWRSLK 328
                      789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.7E-42114238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.36E-38117252IPR015300DNA-binding pseudobarrel domain
CDDcd100175.81E-21121223No hitNo description
PfamPF023623.2E-21123222IPR003340B3 DNA binding domain
PROSITE profilePS5086312.153123225IPR003340B3 DNA binding domain
SMARTSM010193.2E-21123225IPR003340B3 DNA binding domain
PfamPF065076.5E-32249328IPR010525Auxin response factor
PfamPF023092.0E-13556667IPR033389AUX/IAA domain
SuperFamilySSF542772.35E-14573654No hitNo description
PROSITE profilePS5174526.665578659IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MANRLGSLSQ PSSNSDDLYR ELWKACAGPL VDVPKQGQRV YYFPQGHMEQ LEASTNQELN  60
QRIPLFRLPS KILCRVVNIH LMAEQETDEV YAQITLLPEP SQNEPTTPDP CPADSPRPKV  120
HSFSKVLTAS DTSTHGGFSV LRKHATECLP PLDMNQSTPT QELVAKDLHG YEWRFKHIFR  180
GQPRRHLLTT GWSTFVTSKR LVAGDTFVFL RGENGELHVG VRCLARQQSS MPSSVISSQS  240
MHLGVLATAS HAVATQTMFV VYYKPRTSQF IISLNKYLEA VNNKFAVGMR YKMRFEGEDS  300
PDRRFSGTVV GVEDFSPHWK DSKWRSLKVQ WDEPASITRP DRVSPWEIEP FVASATPNLV  360
QPVLAKNKRP RLPMEVPPLD LPSAASAPWS ARLAQSHNLT QLSVTAEDKR IDNHVAWHHK  420
HSDFSSNSNF MSRTQSDGEW LTSPRVKFSQ QLFQEAIDDN KNISAWPAHS GHSTPHPSKP  480
NNDTLLEQVE TGRKTETGTS CRLFGIELIN HATSSAPSEK VPVSSLTTEG HIISTISAAA  540
DSDGKSDIAK EFKEKKQEQV QVSPKESQSK QSCLTSNRSR TKVQMQGVAV GRALDLTTLV  600
GYDHLIDELE EMFDIKGQLH TRTKWEIVYT DDEGDMMLVG DDPWHEFCNM VKRIFICSSQ  660
DVKKMSPGSK LPMFSIEGED ILLSSDSAEK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1731535116355Auxin response factor 1
4ldw_A1e-1731535116355Auxin response factor 1
4ldv_A1e-1731535116355Auxin response factor 1
4ldx_B1e-1731535116355Auxin response factor 1
4ldx_A1e-1731535116355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439306.10.0hypothetical protein CICLE_v10019131mg
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4TRL70.0V4TRL7_9R
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9